PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHM99082.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family NF-YB
Protein Properties Length: 168aa    MW: 19007.3 Da    PI: 5.9301
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHM99082.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB166.43.6e-52499196
       NF-YB  1 vreqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96
                vreqd+++Pianv+rim+++lPa+akis+daket+qecvse+isf+t+ea+++cqre+rkt++++d+lwa+ +lGf++y++pl++yl++yre ege
  KHM99082.1  4 VREQDQYMPIANVIRIMRRILPAHAKISDDAKETIQECVSEYISFITAEANERCQREQRKTVTAEDVLWAMEKLGFDNYAHPLSLYLHRYRESEGE 99
                69*******************************************************************************************997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.101.1E-483110IPR009072Histone-fold
SuperFamilySSF471139.16E-377115IPR009072Histone-fold
PfamPF008082.3E-251074IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006157.7E-163856No hitNo description
PRINTSPR006157.7E-165775No hitNo description
PRINTSPR006157.7E-167694No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 168 aa     Download sequence    Send to blast
MAGVREQDQY MPIANVIRIM RRILPAHAKI SDDAKETIQE CVSEYISFIT AEANERCQRE  60
QRKTVTAEDV LWAMEKLGFD NYAHPLSLYL HRYRESEGEP ASVRRASSAM GINNNMVHPP  120
YINSHGFGMF DFDPSSQGFY RDDHNAASGS GGFVAPFDPY ANIKRDAL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1n1j_A1e-39595393NF-YB
4csr_A1e-39595494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4awl_B1e-39595494NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY0589181e-149AY058918.1 Glycine max clone ses2w.pk0015.a4 CCAAT-box binding factor HAP3 B domain mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003556590.11e-125PREDICTED: nuclear transcription factor Y subunit B-6
SwissprotQ84W665e-60NFYB6_ARATH; Nuclear transcription factor Y subunit B-6
TrEMBLA0A0B2NV021e-125A0A0B2NV02_GLYSO; Nuclear transcription factor Y subunit B-6
TrEMBLI1NCV51e-125I1NCV5_SOYBN; Uncharacterized protein
STRINGGLYMA20G00240.11e-125(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF27283279
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47670.21e-61nuclear factor Y, subunit B6
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]